beta-Endorphin, human [61214-51-5]
HY-P1502
CAS Number61214-51-5
Product group Chemicals
Molecular Weight3464.98
Overview
- SupplierMedChem Express
- Product Namebeta-Endorphin, human [61214-51-5]
- Delivery Days Customer10
- CAS Number61214-51-5
- Molecular FormulaC158H251N39O46S
- Molecular Weight3464.98
- Scientific Descriptionbeta-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, is an agonist of opioid receptor, with preferred affinity for micro-opioid receptor and delta-opioid receptor; beta-Endorphin, human exhibits antinociception activity.
- SMILES[YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE]
- Storage Instruction-20°C,-80°C
- UNSPSC12352200