Sitemap
 
 
Papyracillic Acid A [960148-59-8]
Paprotrain [57046-73-8]
Paprotrain [57046-73-8]
Para-Naphthol Duloxetine [949095-98-1]
3S-Paricalcitol
3S-Paricalcitol
3S-Paricalcitol
3S-Paricalcitol
1S,3S-Paricalcitol
24R-Paricalcitol
Patent Blue V Sodium Salt [20262-76-4]
Pasireotide-d7
PBFI-AM [124549-23-1]
PCA 4248 [123875-01-4]
PCO 400 [121055-10-5]
PD-149163 [169528-11-4]
PD 168568 [210688-56-5]
(2S,3S,4R,5S)-2,3,4,5,6-Pentahydroxy-N-(1-phenylpropan-2-yl)hexanamide
PDAM [78377-23-8]
PD-146176 [4079-26-9]
PD 158780 [171179-06-9]
Pefloxacin Mesylate Dihydrate [149676-40-4]
HO-PEG9-OH [3386-18-3]
PD 174265 [216163-53-0]
PD 174265 [216163-53-0]
Peforelin [147859-97-0]
Peforelin [147859-97-0]
PD 98059 [167869-21-8]
PD 153035 [153436-54-5]
PD 153035 [153436-54-5]
PDNHV [251362-87-5]
PD 102807 [23062-91-1]
PDP-EA [861891-72-7]
Peimine [23496-41-5]
Penconazole-d7 [1628110-84-8]
Penicillide [55303-92-9]
Penigequinolone A [180045-91-4]
Penitrem A [12627-35-9]
Penitrem A [12627-35-9]
4-Penten-1-amine Hydrochloride [27546-60-7]
trans-2-Pentenoic Acid Chloride [33698-85-0]
2-(4-Penten-1-yl)-1H-isoindole-1,3(2H)-dione [7736-25-6]
Perfluoro-1,3,5-triphenylbenzene [59831-92-4]
Perfluoro-1,3,5-triphenylbenzene [59831-92-4]
2-[(4-Phenoxyphenyl)methylene]hydrazinecarbothioamide [3525-78-8]
2-[(4-Phenoxyphenyl)methylene]hydrazinecarbothioamide [3525-78-8]
2-[(4-Phenoxyphenyl)methylene]hydrazinecarbothioamide [3525-78-8]
PDAM [78377-23-8]
(+)-PD 128907 Hydrochloride [300576-59-4]
PD 158780 [171179-06-9]
Pefloxacin Mesylate Dihydrate [149676-40-4]
PDP-EA [861891-72-7]
D-Penicillamine Hydrochloride [2219-30-9]
Penicillic Acid [90-65-3]
Penicillic Acid [90-65-3]
Penicillic Acid [90-65-3]
Penicillanyl Ampicillinamide
Penicillanyl Ampicillinamide
4-Penten-1-amine Hydrochloride [27546-60-7]
trans-2-Pentenoic Acid Chloride [33698-85-0]
2-(4-Penten-1-yl)-1H-isoindole-1,3(2H)-dione [7736-25-6]
Perfluorohexyl Iodide [355-43-1]
Perfluorohexyl Iodide [355-43-1]
Perfluoro-1,3,5-triphenylbenzene [59831-92-4]
Pellitorine [18836-52-7]
Pellitorine [18836-52-7]
Pelrinone [94386-65-9]
1,2,3,7,8-Pentachloronaphthalene Contains H290945 [150205-21-3]
Pentachlorophenyl acetate [1441-02-7]
Pentachlorophenol Sodium Salt [131-52-2]
Pentacosanoic Acid [506-38-7]
2',3',4,4',5-Pentachlorobiphenyl [32598-14-4]
1,1,2,2,2-Pentadeuterioethyl Trideuteriomethyl Carbonate [1313734-97-2]
Pentadecafluorooctanoic Acid Ammonium Salt [3825-26-1]
Pentadecafluorooctanoic Acid Ammonium Salt [3825-26-1]
Pentaethylene Glycol Monodecyl Ether [23244-49-7]
1,1,2,2,3,3,4,4,5,5,6,6,7,7,7-Pentadecafluoro-1-heptanesulfinic Acid Sodium Salt [68555-66-8]
4,4,5,5,5-Pentafluoro-1-pentanethiol [148757-88-4]
2,3-Pentanedione-1,1,1,4,4-d5 [352431-46-0]
2,3-Pentanedione-1,1,1,4,4-d5 [352431-46-0]
2,3-Pentanedione-1,1,1,4,4-d5 [352431-46-0]
Penogenin [507-89-1]
Penogenin [507-89-1]
Pentanochlor [2307-68-8]
4,4-Pentamethylenepiperidine [180-44-9]
Pentanoic-5,5,5-d3 Acid [83741-76-8]
Pentanoic-5,5,5-d3 Acid [83741-76-8]
Pentabromopseudilin [10245-81-5]
(R) - (- ) - 4- Penten- 2- ol [64584-92-5]
Pentosidine-D4 TFA Salt
2-Pentyl-4,6-bis(phenylmethoxy)-benzaldehyde [1528741-09-4]
5-(Pentan-3-yl)-1H-tetrazole [1372810-17-7]
Peonidin Chloride [134-01-0]
PD 168568 [210688-56-5]
(2S,3S,4R,5S)-2,3,4,5,6-Pentahydroxy-N-(1-phenylpropan-2-yl)hexanamide
(+)-PD 128907 Hydrochloride [300576-59-4]
HO-PEG9-OH [3386-18-3]
HO-PEG9-OH [3386-18-3]
HO-PEG9-OH [3386-18-3]
PDK1/Akt/Flt Dual Pathway Inhibitor [331253-86-2]
PDNHV [251362-87-5]
PD 102807 [23062-91-1]
PDP-EA [861891-72-7]
Peimine [23496-41-5]
Penconazole-d7 [1628110-84-8]
D-Penicillamine Hydrochloride [2219-30-9]
Penicillide [55303-92-9]
Penitrem A [12627-35-9]
Penitrem A [12627-35-9]
4-Penten-1-amine Hydrochloride [27546-60-7]
2-(4-Penten-1-yl)-1H-isoindole-1,3(2H)-dione [7736-25-6]
2-(4-Penten-1-yl)-1H-isoindole-1,3(2H)-dione [7736-25-6]
Perfluorohexyl Iodide [355-43-1]
Perfluoro-1,3,5-triphenylbenzene [59831-92-4]
2-[(4-Phenoxyphenyl)methylene]hydrazinecarbothioamide [3525-78-8]
Pellitorine [18836-52-7]
Pellitorine [18836-52-7]
3-Penten-2-one [625-33-2]
3-Penten-2-one [625-33-2]
Pentachlorophenol-13C6 [85380-74-1]
Pentachlorophenol-13C6 [85380-74-1]
Pentachlorophenol-13C6 [85380-74-1]
Pentacosanoic Acid [506-38-7]
2',3',4,4',5-Pentachlorobiphenyl [32598-14-4]
2,3,4,4',5-Pentachlorobiphenyl [74472-37-0]
4-(2-Pentadecyl)phenyl-13C6 1-Sodium Sulfonate
Pentaethylene Glycol Monodecyl Ether [23244-49-7]
Pentaethylene Glycol Monooctyl Ether [19327-40-3]
4,4,5,5,5-Pentafluoro-1-pentanethiol [148757-88-4]
4,4,5,5,5-Pentafluoro-1-pentanethiol [148757-88-4]
2,3-Pentanedione-1,1,1,4,4-d5 [352431-46-0]
2,3-Pentanedione 3-[(2,4-Dinitrophenyl)hydrazone] [51559-14-9]
2,3-Pentanedione 2-[2-(2,4-Dinitrophenyl)hydrazone] [29903-86-4]
4,4-Pentamethylenepiperidine [180-44-9]
Pentanoic-5,5,5-d3 Acid [83741-76-8]
Pentosidine-D4 TFA Salt
Pentachloropyridine [2176-62-7]
Pentachlorothiophenol [133-49-3]
Pentachlorothiophenol [133-49-3]
Pentacosanoic Acid [506-38-7]
2',3',4,4',5-Pentachlorobiphenyl [32598-14-4]
2,3,4,4',5-Pentachlorobiphenyl [74472-37-0]
2,3,4,4',5-Pentachlorobiphenyl [74472-37-0]
4-(2-Pentadecyl)phenyl-13C6 1-Sodium Sulfonate
1,1,2,2,2-Pentadeuterioethyl Trideuteriomethyl Carbonate [1313734-97-2]
1,1,2,2,2-Pentadeuterioethyl Trideuteriomethyl Carbonate [1313734-97-2]
Pentadecafluorooctanoic Acid Ammonium Salt [3825-26-1]
Pentaethylene Glycol Monooctyl Ether [19327-40-3]
N1,N1,N2,N2-Tetrakis(2-aminoethyl)-1,2-ethanediamine [4097-90-9]
2,3-Pentanedione-1,1,1,4,4-d5 [352431-46-0]
2,3-Pentanedione 3-[(2,4-Dinitrophenyl)hydrazone] [51559-14-9]
2,3-Pentanedione 3-[(2,4-Dinitrophenyl)hydrazone] [51559-14-9]
Pentanochlor [2307-68-8]
Pentanochlor [2307-68-8]
Pentanochlor [2307-68-8]
(R) - (- ) - 4- Penten- 2- ol [64584-92-5]
(R) - (- ) - 4- Penten- 2- ol [64584-92-5]
Pentosidine-D4 TFA Salt
2-Pentyl Acetate [626-38-0]
(2S)-2-Pentanamine [54542-13-1]
(2S)-2-Pentanamine [54542-13-1]
Peonidin Chloride-d3
3-Penten-2-one [625-33-2]
Penta-O-pivaloyl-beta-D-glucopyranose [81058-26-6]
Pelrinone [94386-65-9]
Pelrinone [94386-65-9]
Pelrinone [94386-65-9]
Pellitorine [18836-52-7]
1H,1H-Perfluorohexan-1-ol [423-46-1]
Perfluorooctadecanoi c Acid [16517-11-6]
Perfluoro-octylethanoic Acid [27854-31-5]
Perchlorostyrene-13C8
Perchlorostyrene-13C8
Perchlorostyrene-13C8
Perchlorostyrene [29082-74-4]
Peracetyl Empagliflozin [915095-99-7]
Peptide Sequence (MLSKTVAPPQQARVSRKAIRAVPMMKNVNEGKGLFAPLVVVTRNIVGKKRFNQLRGKAIALHSQVITEFCKSIGADAKQRQGLIRLAKKNGERLGFLA)
Pepstatin A [26305-03-3]
Peonidin Chloride-d3
5-(sec-Pentyl)barbituric Acid [83-29-4]
5-(sec-Pentyl)barbituric Acid [83-29-4]
5-(sec-Pentyl)barbituric Acid [83-29-4]
5-(sec-Pentyl)barbituric Acid [83-29-4]
(2S)-2-Pentanamine [54542-13-1]
2-Pentyl-4,6-bis(phenylmethoxy)-benzaldehyde [1528741-09-4]
Peonidin Chloride-d3
Peptide Sequence (MLSKTVAPPQQARVSRKAIRAVPMMKNVNEGKGLFAPLVVVTRNIVGKKRFNQLRGKAIALHSQVITEFCKSIGADAKQRQGLIRLAKKNGERLGFLA)
Peracetyl Empagliflozin [915095-99-7]
Perchlorostyrene [29082-74-4]
Perfluoro(tert-butylcyclohexane) (70%) [84808-64-0]
Perfluoro(tert-butylcyclohexane) (70%) [84808-64-0]
Perfluorobutylethyl Methacrylate [1799-84-4]
Perfluorononan-1-oic-acid Ammonium Salts [4149-60-4]
Perfluorononan-1-oic-acid Ammonium Salts [4149-60-4]
Perfluorodecylethyl Methacrylate [2144-54-9]
p-Perfluoroterphenyl [3008-31-9]
Perfluorotriphenylene [17051-14-8]
Perfluorotriphenylene [17051-14-8]
Pergafast 201-d4
Pergafast 201-d4
Perillic Acid [23635-14-5]
(-)-Perillyl Alcohol [18457-55-1]
(+)-Perillyl alcohol [57717-97-2]
(+)-Perillyl alcohol [57717-97-2]
O-Pentaacetyl O-Desethyl Dapagliflozin
O-Pentaacetyl O-Desethyl Dapagliflozin
Pexidartinib [1029044-16-3]
PF-06840003 [198474-05-4]
PF-06840003 [198474-05-4]
PF 670462 [950912-80-8]
PFK 15 [4382-63-2]
PFK 15 [4382-63-2]
PGJ2 (Prostaglandin J2) [60203-57-8]
(S)-4C-PG [134052-73-6]
PG01037 Dihydrochloride [675599-62-9]
PGF1alpha (Prostaglandin F1alpha) [745-62-0]
PGH2 (Prostaglandin H2) [42935-17-1]
Phaclofen [114012-12-3]
alpha-Phellandrene-D3
2-(Phenacylthio)-2-imidazoline Hydrobromide [32188-94-6]
Phenaglycodol-2,3-O-TMS
Phenamacril [39491-78-6]
Phenol Red Sodium Salt [34487-61-1]
Phenazine Ethosulfate [10510-77-7]
Phenazine [92-82-0]
Phenelzine [51-71-8]
Phenethyl Benzoate [94-47-3]
Phenylsulfenyl Chloride [931-59-9]
Peonidin Chloride [134-01-0]
Peonidin Chloride [134-01-0]
Peonidin Chloride-d3
Peptide Sequence (MLSKTVAPPQQARVSRKAIRAVPMMKNVNEGKGLFAPLVVVTRNIVGKKRFNQLRGKAIALHSQVITEFCKSIGADAKQRQGLIRLAKKNGERLGFLA)
Peracetyl Empagliflozin [915095-99-7]
Perfluoro-octylethanoic Acid [27854-31-5]
Perfluoro-octylethanoic Acid [27854-31-5]
N-(Perfluoro-1-octanesulfonyl) Glycine [2806-24-8]
Perfluorohexadecanoi c Acid [67905-19-5]
Perfluorooctadecanoi c Acid [16517-11-6]
Perfluoro(tert-butylcyclohexane) (70%) [84808-64-0]
Perfluorobutylethyl Methacrylate [1799-84-4]
1H,1H-Perfluorohexan-1-ol [423-46-1]
Perfluoropropanesulfonic Acid [423-41-6]
Pergafast 201-d4
Pergafast 201-d4
Permethrinic Acid Methyl Ester [61898-95-1]
Pethidinic Acid [3627-48-3]
Petunidin Chloride [1429-30-7]
Pexidartinib [1029044-16-3]
PF-06840003 [198474-05-4]
(S)-4C-PG [134052-73-6]
9alpha,11beta-PGF2 (9alpha,11beta-Prostaglandin F2) [38432-87-0]
9alpha,11beta-PGF2 (9alpha,11beta-Prostaglandin F2) [38432-87-0]
PGF1alpha (Prostaglandin F1alpha) [745-62-0]
PGH2 (Prostaglandin H2) [42935-17-1]
PGH2 (Prostaglandin H2) [42935-17-1]
Phalloidine [17466-45-4]
alpha-Phellandrene-D3
alpha-Phellandrene-D3
alpha-Phellandrene-D3
2-(Phenacylthio)-2-imidazoline Hydrobromide [32188-94-6]
2-(Phenacylthio)-2-imidazoline Hydrobromide [32188-94-6]
Phenaglycodol-2,3-O-TMS
Phenaglycodol-2,3-O-TMS
Phenamacril [39491-78-6]
Phenazine Ethosulfate [10510-77-7]
Phenazine [92-82-0]
Phenazine Methosulfate [299-11-6]
Phenelzine [51-71-8]
Phenelzine [51-71-8]
Phenethyl Benzoate [94-47-3]
Phenylsulfenyl Chloride [931-59-9]
Phenylsulfenyl Chloride [931-59-9]
Perfluorobutylethyl Methacrylate [1799-84-4]
Perfluorobutylethyl Methacrylate [1799-84-4]
Phenelzine [51-71-8]
Phenethyl Benzoate [94-47-3]
Phenylsulfenyl Chloride [931-59-9]
Palmitoylamide Propylbetaine [32954-43-1]
2-Palmitoyl-sn-glycero-3-phosphocholine [66757-27-5]
rac-1-Palmitoyl-3-linolenoyl-2-chloropropanediol [1639207-39-8]
rac-1-Palmitoyl-3-linolenoyl-2-chloropropanediol [1639207-39-8]
1-Palmitoyl-2-stearoyl-sn-glycero-3-phosphocholine [59403-51-9]
1-Palmitoyl-2-stearoyl-sn-glycero-3-phosphocholine [59403-51-9]
Panaxatriol [32791-84-7]
Panaxatriol [32791-84-7]
(3R,9R,10R)-(-)-Panaxytriol [87005-03-6]
(3R,9R,10R)-(-)-Panaxytriol [87005-03-6]
Panipenem [87726-17-8]
Phenazine [92-82-0]
Phenazine Ethosulfate [10510-77-7]
Papain [9001-73-4]
3-(N-Acetyl-L-cystein-S-yl) Acetaminophen Replaces A172100 (disodium salt) [52372-86-8]
Paradol [27113-22-0]
Parasin I [219552-69-9]
Parasin I [219552-69-9]
Paraherquamide A [77392-58-6]
Paraherquamide A [77392-58-6]
Parcetasal [87549-36-8]
Phenamacril [39491-78-6]
Phenamacril [39491-78-6]
1S-Paricalcitol
1S,3S-Paricalcitol
Phenaglycodol-2,3-O-TMS
2-(Phenacylthio)-2-imidazoline Hydrobromide [32188-94-6]
Phalloidine [17466-45-4]
14-epi-Paricalcitol
14-epi-Paricalcitol
24R-Paricalcitol
Paroxetine Maleate [64006-44-6]
USP Paroxetine Related Compound E Mixture
Pasireotide [396091-73-9]
Pasireotide [396091-73-9]
PBB 80 [16400-50-3]
PBB 80 [16400-50-3]
PHA 568487 [527680-56-4]
PHA 568487 [527680-56-4]
PB 28 [172906-90-0]
PC-766B [108375-77-5]
PC-766B [108375-77-5]
PD 123319 [130663-39-7]
PD-146176 [4079-26-9]
Pefloxacin Mesylate Dihydrate [149676-40-4]
Pefloxacin Mesylate Dihydrate [149676-40-4]
PD 81,723 [132861-87-1]
PD 81,723 [132861-87-1]
PD 168077 [190383-31-4]
PG01037 Dihydrochloride [675599-62-9]
delta12-PGJ2 (delta12-Prostaglandin J2) [87893-54-7]
Peforelin [147859-97-0]
Peforelin [147859-97-0]
PDK1/Akt/Flt Dual Pathway Inhibitor [331253-86-2]
PFK 15 [4382-63-2]
Pexidartinib [1029044-16-3]
O-Pentaacetyl O-Desethyl Dapagliflozin
Penigequinolone A [180045-91-4]
4-Penten-1-amine Hydrochloride [27546-60-7]
4-Penten-1-amine Hydrochloride [27546-60-7]
trans-2-Pentenoic Acid Chloride [33698-85-0]
Penta-O-pivaloyl-beta-D-glucopyranose [81058-26-6]
Petunidin Chloride [1429-30-7]
Permethrinic Acid Methyl Ester [61898-95-1]
(+)-Perillyl alcohol [57717-97-2]
Perfluorotriphenylene [17051-14-8]
p-Perfluoroterphenyl [3008-31-9]
2,3,4,4',5-Pentachlorobiphenyl [74472-37-0]
4-(2-Pentadecyl)phenyl-13C6 1-Sodium Sulfonate
4-(2-Pentadecyl)phenyl-13C6 1-Sodium Sulfonate
4,4,5,5,5-Pentafluoro-1-pentanethiol [148757-88-4]
Perfluoropropanesulfonic Acid [423-41-6]
Phenelzine [51-71-8]
Phenelzine [51-71-8]
(S) - (+) - Pantolactone [5405-40-3]
Papain [9001-73-4]
Papain [9001-73-4]
1S-Paricalcitol
Penogenin [507-89-1]
Pentanoic-5,5,5-d3 Acid [83741-76-8]
Pentabromopseudilin [10245-81-5]
(R) - (- ) - 4- Penten- 2- ol [64584-92-5]
(R) - (- ) - 4- Penten- 2- ol [64584-92-5]
(R) - (- ) - 4- Penten- 2- ol [64584-92-5]
Pentosidine-D4 TFA Salt
2-Pentyl-4,6-bis(phenylmethoxy)-benzaldehyde [1528741-09-4]
5-(Pentan-3-yl)-1H-tetrazole [1372810-17-7]
5-(Pentan-3-yl)-1H-tetrazole [1372810-17-7]
5-(Pentan-3-yl)-1H-tetrazole [1372810-17-7]
5-(sec-Pentyl)barbituric Acid [83-29-4]
5-(sec-Pentyl)barbituric Acid [83-29-4]
Peonidin Chloride [134-01-0]
Peracetyl Empagliflozin [915095-99-7]
Peracetyl Empagliflozin [915095-99-7]
Perchlorostyrene [29082-74-4]
1S,3S-Paricalcitol
1S,3S-Paricalcitol
1S,3S-Paricalcitol
PB 28 [172906-90-0]
PB 28 [172906-90-0]
PD 168077 [190383-31-4]
HO-PEG9-OH [3386-18-3]
PDP-EA [861891-72-7]
Penconazole-d7 [1628110-84-8]
Penicillic Acid [90-65-3]
Perillic Acid [23635-14-5]
(-)-Perillyl Alcohol [18457-55-1]
(+)-Perillyl alcohol [57717-97-2]
Penta-O-pivaloyl-beta-D-glucopyranose [81058-26-6]
PF 06463922 [1454846-35-5]
PF 06463922 [1454846-35-5]
PF 670462 [950912-80-8]
PFK 15 [4382-63-2]
PGJ2 (Prostaglandin J2) [60203-57-8]
delta12-PGJ2 (delta12-Prostaglandin J2) [87893-54-7]
3-Penten-2-one [625-33-2]
Pentachlorophenol-13C6 [85380-74-1]
Pentachlorophenyl acetate [1441-02-7]
Phaclofen [114012-12-3]
Phalloidine [17466-45-4]
Phalloidine [17466-45-4]
2-(Phenacylthio)-2-imidazoline Hydrobromide [32188-94-6]
Phenaglycodol-2,3-O-TMS
Phenaglycodol-2,3-O-TMS
Phenol Red Sodium Salt [34487-61-1]
Phenazine [92-82-0]
Phenelfamycin E [114451-31-9]
Phenelfamycin E [114451-31-9]
Pentacosanoic Acid [506-38-7]